PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000175446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 76aa    MW: 8851.42 Da    PI: 6.9384
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000175446genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.43e-15646142
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv 42
                   lppGfrFhPtdeelv +yL +k++g+++el e+i++vd+yk+
  MDP0000175446  6 LPPGFRFHPTDEELVAYYLDQKINGRTIEL-EIIPKVDLYKC 46
                   79****************************.99*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-15346IPR003441NAC domain
PROSITE profilePS5100514.645676IPR003441NAC domain
PfamPF023657.6E-9739IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDQKING RTIELEIIPK VDLYKCLLIH VFIIGMHHGF  60
DYKFVNFNNK LQAPVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4656842e-37AM465684.2 Vitis vinifera contig VV78X155772.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371963.13e-26PREDICTED: protein BEARSKIN1-like
RefseqXP_008383208.13e-26PREDICTED: NAC transcription factor 29-like
SwissprotQ9FFI54e-23NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0M4G3Q67e-26A0A0M4G3Q6_MANES; NAC transcription factors 56
STRINGBra003335.1-P3e-25(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.19e-28NAC domain containing protein 20